Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein
CAT#: TP308533M
Recombinant protein of human mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208533 protein sequence
Red=Cloning site Green=Tags(s) MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKK NKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQER QRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIF HQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_690876 |
| Locus ID | 219402 |
| UniProt ID | Q9H2K0 |
| Refseq Size | 1037 |
| Cytogenetics | 13q12.2 |
| Refseq ORF | 834 |
| Synonyms | IF3mt |
| Summary | This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
其它Mitocondrial Translational Initiation Factor 3产品
