ACBD3 (NM_022735) Human Recombinant Protein
CAT#: TP308434
Recombinant protein of human acyl-Coenzyme A binding domain containing 3 (ACBD3), 20 µg
View other "ACBD3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208434 protein sequence
Red=Cloning site Green=Tags(s) MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAE EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGN DRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKE EEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL QEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEE VYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_073572 |
| Locus ID | 64746 |
| UniProt ID | Q9H3P7 |
| Refseq Size | 3581 |
| Cytogenetics | 1q42.12 |
| Refseq ORF | 1584 |
| Synonyms | GCP60; GOCAP1; GOLPH1; PAP7 |
| Summary | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411600 | ACBD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411600 | Transient overexpression lysate of acyl-Coenzyme A binding domain containing 3 (ACBD3) |
CNY 3080.00 |
|
| PH308434 | ACBD3 MS Standard C13 and N15-labeled recombinant protein (NP_073572) |
CNY 19520.00 |
