APOBEC2 (NM_006789) Human Recombinant Protein
CAT#: TP308399
Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2), 20 µg
View other "APOBEC2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208399 representing NM_006789
Red=Cloning site Green=Tags(s) MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFL CYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLS KTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQE NFLYYEEKLADILK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006780 |
Locus ID | 10930 |
UniProt ID | Q9Y235 |
Refseq Size | 1195 |
Cytogenetics | 6p21.1 |
Refseq ORF | 672 |
Synonyms | ARCD1; ARP1 |
Summary | Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416413 | APOBEC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416413 | Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2) |
CNY 3080.00 |
|
PH308399 | APOBEC2 MS Standard C13 and N15-labeled recombinant protein (NP_006780) |
CNY 19520.00 |
其它APOBEC2产品