Hemogen (HEMGN) (NM_018437) Human Recombinant Protein
CAT#: TP308367
Recombinant protein of human hemogen (HEMGN), transcript variant 1, 20 µg
View other "Hemogen" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208367 protein sequence
Red=Cloning site Green=Tags(s) MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK GNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESN IYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVI QDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEP EEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSED YSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKE CFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060907 |
| Locus ID | 55363 |
| UniProt ID | Q9BXL5 |
| Refseq Size | 2252 |
| Cytogenetics | 9q22.33 |
| Refseq ORF | 1449 |
| Synonyms | CT155; EDAG; EDAG-1; NDR |
| Summary | Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402697 | HEMGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405099 | HEMGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402697 | Transient overexpression lysate of hemogen (HEMGN), transcript variant 1 |
CNY 3080.00 |
|
| LY405099 | Transient overexpression lysate of hemogen (HEMGN), transcript variant 2 |
CNY 4840.00 |
|
| PH308367 | HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_060907) |
CNY 19520.00 |
|
| PH314122 | HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_932095) |
CNY 19520.00 |
|
| TP314122 | Recombinant protein of human hemogen (HEMGN), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Hemogen产品
