Alpha 1 microglobulin (AMBP) (NM_001633) Human Recombinant Protein
CAT#: TP308342
Recombinant protein of human alpha-1-microglobulin/bikunin precursor (AMBP), 20 µg
View other "Alpha 1 microglobulin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208342 protein sequence
Red=Cloning site Green=Tags(s) MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVL GEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSR HHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQ EEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQT CRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRF SN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001624 |
| Locus ID | 259 |
| UniProt ID | P02760 |
| Refseq Size | 1450 |
| Cytogenetics | 9q32 |
| Refseq ORF | 1056 |
| Synonyms | A1M; EDC1; HCP; HI30; IATIL; ITI; ITIL; ITILC; UTI |
| Summary | This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Identification of a novel natriuretic protein in patients with cerebral-renal salt wasting - implications for enhanced diagnosis
,Maesaka, J;Imbriano, L;Pinkhasov, A;Muralidharan, R;Song, X;Russo, L;Comper, W;,
The American Journal of the Medical Sciences
[AMBP]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400613 | AMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400613 | Transient overexpression lysate of alpha-1-microglobulin/bikunin precursor (AMBP) |
CNY 3080.00 |
|
| PH308342 | AMBP MS Standard C13 and N15-labeled recombinant protein (NP_001624) |
CNY 19520.00 |
其它Alpha 1 microglobulin产品
