Cathepsin Z (CTSZ) (NM_001336) Human Recombinant Protein
CAT#: TP308341
Recombinant protein of human cathepsin Z (CTSZ), 20 µg
View other "Cathepsin Z" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208341 protein sequence
Red=Cloning site Green=Tags(s) MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001327 |
| Locus ID | 1522 |
| UniProt ID | Q9UBR2 |
| Refseq Size | 1517 |
| Cytogenetics | 20q13.32 |
| Refseq ORF | 909 |
| Synonyms | CTSX |
| Summary | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Lysosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400531 | CTSZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400531 | Transient overexpression lysate of cathepsin Z (CTSZ) |
CNY 3080.00 |
|
| PH308341 | CTSZ MS Standard C13 and N15-labeled recombinant protein (NP_001327) |
CNY 19520.00 |
|
| TP720370 | Recombinant protein of human cathepsin Z (CTSZ) |
CNY 1800.00 |
其它Cathepsin Z产品
