XRCC2 (NM_005431) Human Recombinant Protein
CAT#: TP308330
Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2), 20 µg
View other "XRCC2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 6281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208330 protein sequence
Red=Cloning site Green=Tags(s) MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005422 |
Locus ID | 7516 |
UniProt ID | O43543 |
Refseq Size | 3094 |
Cytogenetics | 7q36.1 |
Refseq ORF | 840 |
Synonyms | FANCU; POF17; SPGF50 |
Summary | This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Homologous recombination |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
,null,
Nature Communications
,PubMed ID 35768435
[XRCC2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417301 | XRCC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417301 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2) |
CNY 3080.00 |
|
PH308330 | XRCC2 MS Standard C13 and N15-labeled recombinant protein (NP_005422) |
CNY 19520.00 |