RNF156 (MGRN1) (NM_015246) Human Recombinant Protein
CAT#: TP308284
Recombinant protein of human mahogunin, ring finger 1 (MGRN1), transcript variant 1, 20 µg
View other "RNF156" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208284 protein sequence
Red=Cloning site Green=Tags(s) MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQF PYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASE EFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDV VEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVV CLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLE HDEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRES SSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPGRPTSMETAHGLATTSPTWPP LGGPSPDPSAAELTPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056061 |
| Locus ID | 23295 |
| UniProt ID | O60291 |
| Refseq Size | 3934 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 1728 |
| Synonyms | RNF156 |
| Summary | Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414714 | MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428013 | MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428014 | MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414714 | Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 1 |
CNY 3080.00 |
|
| LY428013 | Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 3 |
CNY 3080.00 |
|
| LY428014 | Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 4 |
CNY 3080.00 |
|
| PH308284 | MGRN1 MS Standard C13 and N15-labeled recombinant protein (NP_056061) |
CNY 19520.00 |


