SYS1 (NM_033542) Human Recombinant Protein
CAT#: TP308279
Recombinant protein of human SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1, 20 µg
View other "SYS1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208279 protein sequence
Red=Cloning site Green=Tags(s) MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSF ILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMR TELKEIPLNSAPKSNV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_291020 |
Locus ID | 90196 |
UniProt ID | Q8N2H4 |
Refseq Size | 2802 |
Cytogenetics | 20q13.12 |
Refseq ORF | 468 |
Synonyms | C20orf169; dJ453C12.4; dJ453C12.4.1 |
Summary | SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus (Behnia et al., 2004 [PubMed 15077113]).[supplied by OMIM, Aug 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409493 | SYS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409493 | Transient overexpression lysate of SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1 |
CNY 3080.00 |
|
PH308279 | SYS1 MS Standard C13 and N15-labeled recombinant protein (NP_291020) |
CNY 19520.00 |