OLAH (NM_001039702) Human Recombinant Protein
CAT#: TP308251
Recombinant protein of human oleoyl-ACP hydrolase (OLAH), transcript variant 2, 20 µg
View other "OLAH" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208251 protein sequence
Red=Cloning site Green=Tags(s) MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034791 |
Locus ID | 55301 |
UniProt ID | Q9NV23 |
Refseq Size | 1675 |
Cytogenetics | 10p13 |
Refseq ORF | 795 |
Synonyms | AURA1; SAST; TE2; THEDC1 |
Summary | Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Fatty acid biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400421 | OLAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413121 | OLAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400421 | Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 2 |
CNY 3080.00 |
|
LY413121 | Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 1 |
CNY 3080.00 |
|
PH308251 | OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791) |
CNY 19520.00 |