HMGCS2 (NM_005518) Human Recombinant Protein
CAT#: TP308128
Recombinant protein of human 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, 20 µg
View other "HMGCS2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208128 protein sequence
Red=Cloning site Green=Tags(s) MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQ TDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKA VKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGG AGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQ WKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNK DLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTW YLERVDEQHRRKYARRPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005509 |
Locus ID | 3158 |
UniProt ID | P54868 |
Refseq Size | 2477 |
Cytogenetics | 1p12 |
Refseq ORF | 1524 |
Summary | The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Butanoate metabolism, Metabolic pathways, PPAR signaling pathway, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Valine, leucine and isoleucine degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417253 | HMGCS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431416 | HMGCS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417253 | Transient overexpression lysate of 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY431416 | Transient overexpression lysate of 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
PH308128 | HMGCS2 MS Standard C13 and N15-labeled recombinant protein (NP_005509) |
CNY 19520.00 |
|
TP761046 | Purified recombinant protein of Human 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |