CaMKK (CAMKK1) (NM_032294) Human Recombinant Protein
CAT#: TP308102
Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1, 20 µg
View other "CaMKK" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208102 protein sequence
Red=Cloning site Green=Tags(s) MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN VVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSN LLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGK CPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGG KSPELPGVQEDEAAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115670 |
| Locus ID | 84254 |
| UniProt ID | Q8N5S9 |
| Refseq Size | 3583 |
| Cytogenetics | 17p13.2 |
| Refseq ORF | 1515 |
| Synonyms | CAMKKA |
| Summary | The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Adipocytokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406737 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406738 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410237 | CAMKK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406737 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2 |
CNY 4840.00 |
|
| LY406738 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3 |
CNY 3080.00 |
|
| LY410237 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 1 |
CNY 3080.00 |
|
| PH306389 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757344) |
CNY 19520.00 |
|
| PH308102 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_115670) |
CNY 19520.00 |
|
| PH318931 | CAMKK1 MS Standard C13 and N15-labeled recombinant protein (NP_757343) |
CNY 19520.00 |
|
| TP306389 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318931 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 1, alpha (CAMKK1), transcript variant 2, 20 µg |
CNY 2900.00 |
