FOXP4 (NM_138457) Human Recombinant Protein
CAT#: TP308077
Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 2, 20 µg
View other "FOXP4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208077 protein sequence
Red=Cloning site Green=Tags(s) MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQAL QVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQ QLQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGLVSLQPNQA SGPLQTLPQAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDLTGTAATATSFAAPPKVSPPLSHHTLPNGQ PTVLTSRRDSSSHEETPGSHPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQ LEIQLAKESERLQAMMAHLHMRPSEPKPFSQPVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGLGSASLH GGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAY FRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMTGSPTLVKNMISGLSYGALNAS YQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAE AEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 72 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612466 |
Locus ID | 116113 |
UniProt ID | Q8IVH2 |
Refseq Size | 5926 |
Cytogenetics | 6p21.1 |
Refseq ORF | 2001 |
Synonyms | hFKHLA |
Summary | This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408607 | FOXP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422862 | FOXP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408607 | Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 2 |
CNY 3080.00 |
|
LY422862 | Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 1 |
CNY 3080.00 |
|
PH308077 | FOXP4 MS Standard C13 and N15-labeled recombinant protein (NP_612466) |
CNY 19520.00 |
|
PH308611 | FOXP4 MS Standard C13 and N15-labeled recombinant protein (NP_001012426) |
CNY 19520.00 |
|
TP308611 | Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 1, 20 µg |
CNY 2900.00 |