BCKDHB (NM_183050) Human Recombinant Protein
CAT#: TP308059
Recombinant protein of human branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "BCKDHB" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208059 protein sequence
Red=Cloning site Green=Tags(s) MAVVAAAAGWLLRLRAAGAEGHWRRLPGAGLARGFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQK MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTG ATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGI KVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQ VHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECF LNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_898871 |
| Locus ID | 594 |
| UniProt ID | P21953 |
| Refseq Size | 3712 |
| Cytogenetics | 6q14.1 |
| Refseq ORF | 1176 |
| Synonyms | BCKDE1B; BCKDH E1-beta; E1B |
| Summary | This gene encodes the E1 beta subunit of branched-chain keto acid dehydrogenase, which is a multienzyme complex associated with the inner membrane of mitochondria. This enzyme complex functions in the catabolism of branched-chain amino acids. Mutations in this gene have been associated with maple syrup urine disease (MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physical retardation and feeding problems. Alternative splicing at this locus results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Protein Pathways | Metabolic pathways, Valine, leucine and isoleucine degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400014 | BCKDHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405219 | BCKDHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400014 | Transient overexpression lysate of branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY405219 | Transient overexpression lysate of branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH308059 | BCKDHB MS Standard C13 and N15-labeled recombinant protein (NP_898871) |
CNY 19520.00 |
|
| TP761638 | Purified recombinant protein of Human 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial isoform 1 precursor (BCKDHB), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
