ARPC1A (NM_006409) Human Recombinant Protein
CAT#: TP308053
Recombinant protein of human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), 20 µg
View other "ARPC1A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208053 protein sequence
Red=Cloning site Green=Tags(s) MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTC GADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV SFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL TFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG AMTIWDFKTLESSIQGLRIM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006400 |
Locus ID | 10552 |
UniProt ID | Q92747 |
Refseq Size | 1623 |
Cytogenetics | 7q22.1 |
Refseq ORF | 1110 |
Synonyms | Arc40; HEL-68; HEL-S-307; SOP2Hs; SOP2L |
Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1B. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416669 | ARPC1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433813 | ARPC1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416669 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A) |
CNY 3080.00 |
|
LY433813 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 2 |
CNY 3080.00 |
|
PH308053 | ARPC1A MS Standard C13 and N15-labeled recombinant protein (NP_006400) |
CNY 19520.00 |