UBF1 (UBTF) (NM_001076683) Human Recombinant Protein
CAT#: TP308047
Recombinant protein of human upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 2, 20 µg
View other "UBF1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208047 representing NM_001076683
Red=Cloning site Green=Tags(s) MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKL KWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNL DLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHE KKVYLKVRPDEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMK DVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQA TSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYK AREAALKAQSERKPGGEREERGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEK LMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERM VEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLRGPNPKSS RTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDD DEDEDNESEGSSSSSSSSGDSSDSDSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 84.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001070151 |
Locus ID | 7343 |
UniProt ID | P17480 |
Refseq Size | 4635 |
Cytogenetics | 17q21.31 |
Refseq ORF | 2181 |
Synonyms | CONDBA; NOR-90; UBF; UBF-1; UBF1; UBF2 |
Summary | This gene encodes a member of the HMG-box DNA-binding protein family. The encoded protein plays a critical role in ribosomal RNA transcription as a key component of the pre-initiation complex, mediating the recruitment of RNA polymerase I to rDNA promoter regions. The encoded protein may also play important roles in chromatin remodeling and pre-rRNA processing, and its activity is regulated by both phosphorylation and acetylation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Pseudogenes of this gene are located on the short arm of chromosomes 3, 11 and X and the long arm of chromosome 11. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421360 | UBTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421361 | UBTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC425832 | UBTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY421360 | Transient overexpression lysate of upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 2 |
CNY 3080.00 |
|
LY421361 | Transient overexpression lysate of upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 3 |
CNY 4840.00 |
|
LY425832 | Transient overexpression lysate of upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 2 |
CNY 4840.00 |
|
PH308047 | UBTF MS Standard C13 and N15-labeled recombinant protein (NP_001070151) |
CNY 19520.00 |