MARCHF3 (NM_178450) Human Recombinant Protein
CAT#: TP307968
Recombinant protein of human membrane-associated ring finger (C3HC4) 3 (MARCH3), 20 µg
View other "MARCHF3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207968 representing NM_178450
Red=Cloning site Green=Tags(s) MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848545 |
Locus ID | 115123 |
UniProt ID | Q86UD3 |
Refseq Size | 1816 |
Cytogenetics | 5q23.2 |
Refseq ORF | 759 |
Synonyms | MARCH-III; MARCH3; RNF173 |
Summary | This gene encodes a member of the membrane-associated RING-CH (MARCH) family. The encoded protein is an E3 ubiquitin-protein ligase that may be involved in regulation of the endosomal transport pathway. [provided by RefSeq, Mar 2013] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405925 | 42066 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405925 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 3 (MARCH3) |
CNY 3080.00 |
|
PH307968 | MARCH3 MS Standard C13 and N15-labeled recombinant protein (NP_848545) |
CNY 19520.00 |
其它MARCHF3产品