PDSS2 (NM_020381) Human Recombinant Protein
CAT#: TP307892
Recombinant protein of human prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2), 20 µg
View other "PDSS2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207892 protein sequence
Red=Cloning site Green=Tags(s) MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIREAQEKGRLDYAKLRE RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065114 |
| Locus ID | 57107 |
| UniProt ID | Q86YH6 |
| Refseq Size | 3568 |
| Cytogenetics | 6q21 |
| Refseq ORF | 1197 |
| Synonyms | bA59I9.3; C6orf210; COQ1B; COQ10D3; DLP1; hDLP1 |
| Summary | The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. Defects in this gene are a cause of coenzyme Q10 deficiency.[provided by RefSeq, Oct 2009] |
| Protein Pathways | Terpenoid backbone biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412512 | PDSS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412512 | Transient overexpression lysate of prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2) |
CNY 3080.00 |
|
| PH307892 | PDSS2 MS Standard C13 and N15-labeled recombinant protein (NP_065114) |
CNY 19520.00 |


