CYRIA (NM_030797) Human Recombinant Protein
CAT#: TP307880
Recombinant protein of human family with sequence similarity 49, member A (FAM49A), 20 µg
View other "CYRIA" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207880 protein sequence
Red=Cloning site Green=Tags(s) MGNLLKVLTREIENYPHFFLDFENAQPTEGEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPN DIQLQEKAWNAVCPLVVRLKRFYEFSIRLEKALQSLLESLTCPPYTPTQHLEREQALAKEFAEILHFTLR FDELKMRNPAIQNDFSYYRRTISRNRINNMHLDIENEVNNEMANRMSLFYAEATPMLKTLSNATMHFVSE NKTLPIENTTDCLSTMTSVCKVMLETPEYRSRFTSEETLMFCMRVMVGVIILYDHVHPVGAFCKTSKIDM KGCIKVLKEQAPDSVEGLLNALRFTTKHLNDESTSKQIRAMLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_110424 |
Locus ID | 81553 |
UniProt ID | Q9H0Q0 |
Refseq Size | 4702 |
Cytogenetics | 2p24.2 |
Refseq ORF | 969 |
Synonyms | CYRI-A; FAM49A |
Summary | May negatively regulate RAC1 signaling and RAC1-driven cytoskeletal remodeling (Probable). May regulate chemotaxis, cell migration and epithelial polarization by controlling the polarity, plasticity, duration and extent of protrusions (Probable).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410693 | FAM49A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410693 | Transient overexpression lysate of family with sequence similarity 49, member A (FAM49A) |
CNY 3080.00 |
|
PH307880 | FAM49A MS Standard C13 and N15-labeled recombinant protein (NP_110424) |
CNY 19520.00 |