GRHL3 (NM_198174) Human Recombinant Protein
CAT#: TP307857
Purified recombinant protein of Homo sapiens grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3, 20 µg
View other "GRHL3" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207857 protein sequence
Red=Cloning site Green=Tags(s) MRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENV SGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVP PTQRWQPDSTFKDDPQESMLFPDILKTSPEPPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQ FYPVTLRTPAGGKGLALSSNKVKSVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTV EHIEEVAYNALSFVWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIK IFCDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSS LQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDLQRVLLYVRRETEEVFDALMLKTPDL KGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNNIIQHYSNHVAFLLDMGELDGKIQIILKEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_937817 |
| Locus ID | 57822 |
| UniProt ID | Q8TE85 |
| Refseq Size | 2232 |
| Cytogenetics | 1p36.11 |
| Refseq ORF | 1665 |
| Synonyms | SOM; TFCP2L4; VWS2 |
| Summary | This gene encodes a member of the grainyhead family of transcription factors. The encoded protein may function as a transcription factor during development, and has been shown to stimulate migration of endothelial cells. Multiple transcript variants encoding distinct isoforms have been identified for this gene.[provided by RefSeq, Aug 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404981 | GRHL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412043 | GRHL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY404981 | Transient overexpression lysate of grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3 |
CNY 3080.00 |
|
| LY412043 | Transient overexpression lysate of grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 1 |
CNY 4840.00 |
|
| PH307857 | GRHL3 MS Standard C13 and N15-labeled recombinant protein (NP_937817) |
CNY 14250.00 |
|
| TP760712 | Purified recombinant protein of Human grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
