FKBP6 (NM_003602) Human Recombinant Protein
CAT#: TP307712
Recombinant protein of human FK506 binding protein 6, 36kDa (FKBP6), transcript variant 1, 20 µg
View other "FKBP6" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207712 protein sequence
Red=Cloning site Green=Tags(s) MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDR PFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL DFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLRRRSAPPEE QHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003593 |
| Locus ID | 8468 |
| UniProt ID | O75344 |
| Refseq Size | 1640 |
| Cytogenetics | 7q11.23 |
| Refseq ORF | 981 |
| Synonyms | FKBP36 |
| Summary | The protein encoded by this gene is a cis-trans peptidyl-prolyl isomerase that may function in immunoregulation and basic cellular processes involving protein folding and trafficking. This gene is located in a chromosomal region that is deleted in Williams-Beuren syndrome. Defects in this gene may cause male infertility. There are multiple pseudogenes for this gene located nearby on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418553 | FKBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427592 | FKBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418553 | Transient overexpression lysate of FK506 binding protein 6, 36kDa (FKBP6), transcript variant 1 |
CNY 3080.00 |
|
| LY427592 | Transient overexpression lysate of FK506 binding protein 6, 36kDa (FKBP6), transcript variant 2 |
CNY 3080.00 |
|
| PH307712 | FKBP6 MS Standard C13 and N15-labeled recombinant protein (NP_003593) |
CNY 19520.00 |
