MAST4 (NM_198828) Human Recombinant Protein
CAT#: TP307706
Recombinant protein of human microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2, 20 µg
View other "MAST4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207706 representing NM_198828
Red=Cloning site Green=Tags(s) MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLG GTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPD VASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSL TASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_942123 |
| Locus ID | 375449 |
| UniProt ID | O15021 |
| Refseq Size | 1105 |
| Cytogenetics | 5q12.3 |
| Refseq ORF | 750 |
| Summary | This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404775 | MAST4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404775 | Transient overexpression lysate of microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2 |
CNY 3080.00 |
|
| PH307706 | MAST4 MS Standard C13 and N15-labeled recombinant protein (NP_942123) |
CNY 14250.00 |
