D aspartate oxidase (DDO) (NM_003649) Human Recombinant Protein
CAT#: TP307622
Recombinant protein of human D-aspartate oxidase (DDO), transcript variant 1, 20 µg
View other "D aspartate oxidase" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207622 protein sequence
Red=Cloning site Green=Tags(s) MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDT TSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV VLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNC SGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSR EILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAA RLVSECVHALRTPIPKSNL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003640 |
Locus ID | 8528 |
UniProt ID | Q99489 |
Refseq Size | 1733 |
Cytogenetics | 6q21 |
Refseq ORF | 1107 |
Synonyms | DASOX; DDO-1; DDO-2 |
Summary | The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2019] |
Protein Pathways | Alanine, aspartate and glutamate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401207 | DDO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418289 | DDO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401207 | Transient overexpression lysate of D-aspartate oxidase (DDO), transcript variant 1 |
CNY 3080.00 |
|
LY418289 | Transient overexpression lysate of D-aspartate oxidase (DDO), transcript variant 2 |
CNY 3080.00 |
|
PH307622 | DDO MS Standard C13 and N15-labeled recombinant protein (NP_003640) |
CNY 19520.00 |
|
TP761486 | Purified recombinant protein of Human D-aspartate oxidase (DDO), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |
其它D aspartate oxidase产品