Dermatopontin (DPT) (NM_001937) Human Recombinant Protein
CAT#: TP307588
Recombinant protein of human dermatopontin (DPT), 20 µg
View other "Dermatopontin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207588 protein sequence
Red=Cloning site Green=Tags(s) MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP YSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001928 |
Locus ID | 1805 |
UniProt ID | Q07507 |
Refseq Size | 1749 |
Cytogenetics | 1q24.2 |
Refseq ORF | 603 |
Synonyms | TRAMP |
Summary | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419639 | DPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419639 | Transient overexpression lysate of dermatopontin (DPT) |
CNY 3080.00 |
|
PH307588 | DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928) |
CNY 19520.00 |
|
TP721061 | Purified recombinant protein of Human dermatopontin (DPT) |
CNY 1800.00 |
其它Dermatopontin产品