Calcium independent Phospholipase A2 (PLA2G6) (NM_003560) Human Recombinant Protein
CAT#: TP307546
Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, 20 µg
View other "Calcium independent Phospholipase A2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207546 representing NM_003560
Red=Cloning site Green=Tags(s) MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKG LIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPL EEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLV WRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQ VPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIML DEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 89.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003551 |
Locus ID | 8398 |
UniProt ID | O60733 |
Refseq Size | 3239 |
Cytogenetics | 22q13.1 |
Refseq ORF | 2418 |
Synonyms | CaI-PLA2; GVI; INAD1; iPLA2; IPLA2-VIA; iPLA2beta; NBIA2; NBIA2A; NBIA2B; PARK14; PLA2; PNPLA9 |
Summary | The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. [provided by RefSeq, Dec 2010] |
Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
ZDHHC11 modulates innate immune response to DNA virus by mediating MITA–IRF3 association
,null,
Cellular and Molecular Immunology
,PubMed ID 29429998
[PLA2G6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400377 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418601 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400377 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2 |
CNY 3080.00 |
|
LY418601 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1 |
CNY 3080.00 |
|
PH307546 | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_003551) |
CNY 19520.00 |
|
PH308735 | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_001004426) |
CNY 19520.00 |
|
TP308735 | Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Calcium independent Phospholipase A2产品