TRAPPC1 (NM_021210) Human Recombinant Protein
CAT#: TP307483
Recombinant protein of human trafficking protein particle complex 1 (TRAPPC1), 20 µg
View other "TRAPPC1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207483 protein sequence
Red=Cloning site Green=Tags(s) MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF SARAG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_067033 |
| Locus ID | 58485 |
| UniProt ID | Q9Y5R8 |
| Refseq Size | 837 |
| Cytogenetics | 17p13.1 |
| Refseq ORF | 435 |
| Synonyms | BET5; MUM2 |
| Summary | This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412013 | TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432581 | TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412013 | Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 1 |
CNY 3080.00 |
|
| LY432581 | Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 2 |
CNY 3080.00 |
|
| PH307483 | TRAPPC1 MS Standard C13 and N15-labeled recombinant protein (NP_067033) |
CNY 19520.00 |
其它TRAPPC1产品
