CTRP4 (C1QTNF4) (NM_031909) Human Recombinant Protein
CAT#: TP307458
Recombinant protein of human C1q and tumor necrosis factor related protein 4 (C1QTNF4), 20 µg
View other "CTRP4" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207458 protein sequence
Red=Cloning site Green=Tags(s) MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114115 |
Locus ID | 114900 |
UniProt ID | Q9BXJ3 |
Refseq Size | 1436 |
Cytogenetics | 11p11.2 |
Refseq ORF | 987 |
Synonyms | CTRP4; ZACRP4 |
Summary | May be involved in the regulation of the inflammatory network. Its role as pro- or anti-inflammatory seems to be context dependent (PubMed:21658842, PubMed:27086950). Seems to have some role in regulating food intake and energy balance when administered in the brain. This effect is sustained over a two-day period, and it is accompanied by decreased expression of orexigenic neuropeptides in the hypothalamus 3 h post-injection (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410444 | C1QTNF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410444 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 4 (C1QTNF4) |
CNY 3080.00 |
|
PH307458 | C1QTNF4 MS Standard C13 and N15-labeled recombinant protein (NP_114115) |
CNY 14250.00 |
|
TP701103 | Purified recombinant protein of Human C1q and tumor necrosis factor related protein 4 (C1QTNF4), Leu17-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug |
CNY 7490.00 |