Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein
CAT#: TP307428L
Recombinant protein of human glutathione peroxidase 7 (GPX7), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 6281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207428 protein sequence
Red=Cloning site Green=Tags(s) MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056511 |
Locus ID | 2882 |
UniProt ID | Q96SL4 |
Refseq Size | 1246 |
Cytogenetics | 1p32.3 |
Refseq ORF | 561 |
Synonyms | CL683; GPx-7; GPX6; GSHPx-7; NPGPx |
Summary | It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Arachidonic acid metabolism, Glutathione metabolism |
Documents
FAQs |
SDS |
其它Glutathione Peroxidase 7产品