MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein
CAT#: TP307294
Recombinant protein of human myosin, light chain 12A, regulatory, non-sarcomeric (MYL12A), 20 µg
View other "MRCL3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207294 protein sequence
Red=Cloning site Green=Tags(s) MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE LYREAPIDKKGNFNYIEFTRILKHGAKDKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006462 |
Locus ID | 10627 |
UniProt ID | P19105 |
Refseq Size | 1243 |
Cytogenetics | 18p11.31 |
Refseq ORF | 513 |
Synonyms | HEL-S-24; MLC-2B; MLCB; MRCL3; MRLC3; MYL2B |
Summary | This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416623 | MYL12A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416623 | Transient overexpression lysate of myosin, light chain 12A, regulatory, non-sarcomeric (MYL12A) |
CNY 3080.00 |
|
PH307294 | MYL12A MS Standard C13 and N15-labeled recombinant protein (NP_006462) |
CNY 19520.00 |