TMEM188 (CNEP1R1) (NM_153261) Human Recombinant Protein
CAT#: TP307243
Recombinant protein of human transmembrane protein 188 (TMEM188), 20 µg
View other "TMEM188" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207243 protein sequence
Red=Cloning site Green=Tags(s) MNSLEQAEAPRVVSLIPAVVSGNCQDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDP ETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPH VQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_694993 |
Locus ID | 255919 |
UniProt ID | Q8N9A8 |
Refseq Size | 2201 |
Cytogenetics | 16q12.1 |
Refseq ORF | 426 |
Synonyms | C16orf69; NEP1-R1; NEP1R1; TMEM188; TMP125 |
Summary | This gene encodes a transmembrane protein that belongs to the Tmemb_18A family. A similar protein in yeast is a component of an endoplasmic reticulum-associated protein phosphatase complex and is thought to play a role in the synthesis of triacylglycerol. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407111 | CNEP1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407111 | Transient overexpression lysate of transmembrane protein 188 (TMEM188) |
CNY 3080.00 |
|
PH307243 | TMEM188 MS Standard C13 and N15-labeled recombinant protein (NP_694993) |
CNY 19520.00 |
其它TMEM188产品