LYNX1-SLURP2 (NM_023946) Human Recombinant Protein
CAT#: TP307126
Recombinant protein of human Ly6/neurotoxin 1 (LYNX1), transcript variant 1, 20 µg
View other "LYNX1-SLURP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207126 representing NM_023946
Red=Cloning site Green=Tags(s) MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSH GSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_076435 |
| Locus ID | 111188157 |
| UniProt ID | P0DP58 |
| Refseq Size | 1352 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 393 |
| Summary | This locus represents naturally occurring read-through transcription between the neighboring LYNX1 and SLURP2 genes. The readthrough transcript encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The significance of this read-through transcription and the function of the resulting protein product have not yet been determined. [provided by RefSeq, Sep 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411399 | LYNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411399 | Transient overexpression lysate of Ly6/neurotoxin 1 (LYNX1), transcript variant 1 |
CNY 3080.00 |
|
| PH307126 | LYNX1 MS Standard C13 and N15-labeled recombinant protein (NP_076435) |
CNY 14250.00 |
其它LYNX1-SLURP2产品
