AADAC (NM_001086) Human Recombinant Protein
CAT#: TP307111
Recombinant protein of human arylacetamide deacetylase (esterase) (AADAC), 20 µg
View other "AADAC" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207111 protein sequence
Red=Cloning site Green=Tags(s) MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDE VPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVV VSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKI KLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKF VNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL MYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001077 |
Locus ID | 13 |
UniProt ID | P22760 |
Refseq Size | 1725 |
Cytogenetics | 3q25.1 |
Refseq ORF | 1197 |
Synonyms | CES5A1; DAC |
Summary | Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Shipping | Dry Ice |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Influence of N-acetyltransferase 2 gene polymorphisms on the in vitro metabolism of the epidermal growth factor receptor inhibitor rociletinib
,Ramirez, J;House, LK;Ratain, MJ;,
British journal of clinical pharmacology
,PubMed ID 33818816
[AADAC]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421330 | AADAC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421330 | Transient overexpression lysate of arylacetamide deacetylase (esterase) (AADAC) |
CNY 3080.00 |
|
PH307111 | AADAC MS Standard C13 and N15-labeled recombinant protein (NP_001077) |
CNY 19520.00 |