AADAC (NM_001086) Human Recombinant Protein
CAT#: TP307111
Recombinant protein of human arylacetamide deacetylase (esterase) (AADAC), 20 µg
View other "AADAC" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207111 protein sequence
Red=Cloning site Green=Tags(s) MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDE VPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVV VSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKI KLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKF VNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL MYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001077 |
| Locus ID | 13 |
| UniProt ID | P22760 |
| Refseq Size | 1725 |
| Cytogenetics | 3q25.1 |
| Refseq ORF | 1197 |
| Synonyms | CES5A1; DAC |
| Summary | Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Shipping | Dry Ice |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Influence of N-acetyltransferase 2 gene polymorphisms on the in vitro metabolism of the epidermal growth factor receptor inhibitor rociletinib
,Ramirez, J;House, LK;Ratain, MJ;,
British journal of clinical pharmacology
,PubMed ID 33818816
[AADAC]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421330 | AADAC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421330 | Transient overexpression lysate of arylacetamide deacetylase (esterase) (AADAC) |
CNY 3080.00 |
|
| PH307111 | AADAC MS Standard C13 and N15-labeled recombinant protein (NP_001077) |
CNY 19520.00 |
