ACYP1 (NM_001107) Human Recombinant Protein
CAT#: TP307110
Recombinant protein of human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, 20 µg
View other "ACYP1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC207110 protein sequence 
Red=Cloning site Green=Tags(s) MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG SPKSHIDKANFNNEKVILKLDYSDFQIVK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 11.1 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001098 | 
| Locus ID | 97 | 
| UniProt ID | P07311 | 
| Refseq Size | 621 | 
| Cytogenetics | 14q24.3 | 
| Refseq ORF | 297 | 
| Synonyms | ACYPE | 
| Summary | This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] | 
| Protein Pathways | Pyruvate metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC420125 | ACYP1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY420125 | Transient overexpression lysate of acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH307110 | ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098) | 
                                                     CNY 19520.00  | 
                                            
