OSGEP (NM_017807) Human Recombinant Protein
CAT#: TP307089
Recombinant protein of human O-sialoglycoprotein endopeptidase (OSGEP), 20 µg
View other "OSGEP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207089 protein sequence
Red=Cloning site Green=Tags(s) MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQD IDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIA YSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSF IEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQER GARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060277 |
| Locus ID | 55644 |
| UniProt ID | Q9NPF4 |
| Refseq Size | 1642 |
| Cytogenetics | 14q11.2 |
| Refseq ORF | 1005 |
| Synonyms | GAMOS3; GCPL1; KAE1; OSGEP1; PRSMG1; TCS3 |
| Summary | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402616 | OSGEP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402616 | Transient overexpression lysate of O-sialoglycoprotein endopeptidase (OSGEP) |
CNY 3080.00 |
|
| PH307089 | OSGEP MS Standard C13 and N15-labeled recombinant protein (NP_060277) |
CNY 19520.00 |
