Alpha SNAP (NAPA) (NM_003827) Human Recombinant Protein
CAT#: TP307037
Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), 20 µg
View other "Alpha SNAP" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207037 protein sequence
Red=Cloning site Green=Tags(s) MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML LRIKKTIQGDEEDLR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 33.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003818 |
| Locus ID | 8775 |
| UniProt ID | P54920 |
| Refseq Size | 1865 |
| Cytogenetics | 19q13.32-q13.33 |
| Refseq ORF | 885 |
| Synonyms | SNAPA |
| Summary | This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jun 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401256 | NAPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401256 | Transient overexpression lysate of N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) |
CNY 3080.00 |
|
| PH307037 | NAPA MS Standard C13 and N15-labeled recombinant protein (NP_003818) |
CNY 19520.00 |
|
| TP720247 | Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) |
CNY 1800.00 |
其它Alpha SNAP产品
