RAB20 (NM_017817) Human Recombinant Protein
CAT#: TP306834
Recombinant protein of human RAB20, member RAS oncogene family (RAB20), 20 µg
View other "RAB20" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206834 protein sequence
Red=Cloning site Green=Tags(s) MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYC RGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDR VSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRA ERPSHTVDISSHKPPKRTRSGCCA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060287 |
| Locus ID | 55647 |
| UniProt ID | Q9NX57 |
| Refseq Size | 1530 |
| Cytogenetics | 13q34 |
| Refseq ORF | 702 |
| Summary | Plays a role in apical endocytosis/recycling. Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413526 | RAB20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413526 | Transient overexpression lysate of RAB20, member RAS oncogene family (RAB20) |
CNY 3080.00 |
|
| PH306834 | RAB20 MS Standard C13 and N15-labeled recombinant protein (NP_060287) |
CNY 19520.00 |
