MGC34774 (NM_203308) Human Recombinant Protein
CAT#: TP306664
Recombinant protein of human ribosomal protein L13A-like (MGC34774), 20 µg
View other "MGC34774" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC206664 representing NM_203308 
Red=Cloning site Green=Tags(s) MNSVSVVMMLTSKPLHILGRFITKPLLFTNSMENFELTPSRHGRVHHQSCHEAPRTYKVAAEDSRKTEPG AQWPRPSCGPPGSHLGQVGSAGKETGGRAPRGHQHFWQFLEKQIKVSGLPLQADEHQPFPRPARPAIPGP PAHLLVALQNQVGPGCPGPPYGVLWDLTAL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 19 | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_976053 | 
| Locus ID | 399670 | 
| Refseq Size | 1848 | 
| Cytogenetics | 7q21.11 | 
| Refseq ORF | 510 | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC404390 | MGC34774 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY404390 | Transient overexpression lysate of ribosomal protein L13A-like (MGC34774) | 
                                                     CNY 3080.00  | 
                                            |
| PH306664 | MGC34774 MS Standard C13 and N15-labeled recombinant protein (NP_976053) | 
                                                     CNY 19520.00  | 
                                            
其它MGC34774产品
