Cytoglobin (CYGB) (NM_134268) Human Recombinant Protein
CAT#: TP306642
Recombinant protein of human cytoglobin (CYGB), 20 µg
View other "Cytoglobin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206642 protein sequence
Red=Cloning site Green=Tags(s) MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_599030 |
Locus ID | 114757 |
UniProt ID | Q8WWM9 |
Refseq Size | 2166 |
Cytogenetics | 17q25.1 |
Refseq ORF | 570 |
Synonyms | HGB; STAP |
Summary | This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation. [provided by RefSeq, Jan 2012] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Strong modulation of nitrite reductase activity of cytoglobin by disulfide bond oxidation: Implications for nitric oxide homeostasis.
,null,
Nitric oxide : biology and chemistry
,PubMed ID 29128400
[CYGB]
|
Peroxidase Activation of Cytoglobin by Anionic phospholipids: Mechanisms and Consequences
,null,
Biochimica et biophysica acta
,PubMed ID 26928591
[CYGB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408741 | CYGB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408741 | Transient overexpression lysate of cytoglobin (CYGB) |
CNY 3080.00 |
|
PH306642 | CYGB MS Standard C13 and N15-labeled recombinant protein (NP_599030) |
CNY 19520.00 |
|
TP720611 | Purified recombinant protein of Human cytoglobin (CYGB) |
CNY 1800.00 |
其它Cytoglobin产品