Acyloxyacyl Hydrolase (AOAH) (NM_001637) Human Recombinant Protein
CAT#: TP306619
Recombinant protein of human acyloxyacyl hydrolase (neutrophil) (AOAH), 20 µg
View other "Acyloxyacyl Hydrolase" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206619 protein sequence
Red=Cloning site Green=Tags(s) MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLC SYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKA RQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSD ESVYPGRRPNNWDVHQDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQM SLNSFINLPTALTNELDWPQLSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKF IESLSRNKVLDYPAIVIYAMIGNDVCSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPD GTFLWDNLHNRYHPLGQLNKDMTYAQLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAAS EKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENP FNPQIKQVFGDQGGH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 62.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001628 |
| Locus ID | 313 |
| UniProt ID | P28039 |
| Refseq Size | 2440 |
| Cytogenetics | 7p14.2 |
| Refseq ORF | 1725 |
| Summary | This locus encodes both the light and heavy subunits of acyloxyacyl hydrolase. The encoded enzyme catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides, effectively detoxifying these molecules. The encoded protein may play a role in modulating host inflammatory response to gram-negative bacteria. Alternatively spliced transcript variants have been described.[provided by RefSeq, Apr 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400615 | AOAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433253 | AOAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433429 | AOAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400615 | Transient overexpression lysate of acyloxyacyl hydrolase (neutrophil) (AOAH) |
CNY 3080.00 |
|
| LY433253 | Transient overexpression lysate of acyloxyacyl hydrolase (neutrophil) (AOAH), transcript variant 3 |
CNY 3080.00 |
|
| LY433429 | Transient overexpression lysate of acyloxyacyl hydrolase (neutrophil) (AOAH), transcript variant 2 |
CNY 4840.00 |
|
| PH306619 | AOAH MS Standard C13 and N15-labeled recombinant protein (NP_001628) |
CNY 19520.00 |
其它Acyloxyacyl Hydrolase产品
