MPPED2 (NM_001584) Human Recombinant Protein
CAT#: TP306617
Recombinant protein of human metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1, 20 µg
View other "MPPED2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206617 protein sequence
Red=Cloning site Green=Tags(s) MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT NPPIIFDLPNPQGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001575 |
Locus ID | 744 |
UniProt ID | Q15777 |
Refseq Size | 2404 |
Cytogenetics | 11p14.1 |
Refseq ORF | 882 |
Synonyms | 239FB; C11orf8 |
Summary | This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419851 | MPPED2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419851 | Transient overexpression lysate of metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1 |
CNY 3080.00 |
|
PH306617 | MPPED2 MS Standard C13 and N15-labeled recombinant protein (NP_001575) |
CNY 19520.00 |