GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein
CAT#: TP306595
Recombinant protein of human guanylate cyclase activator 1A (retina) (GUCA1A), 20 µg
View other "GCAP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206595 protein sequence
Red=Cloning site Green=Tags(s) MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000400 |
Locus ID | 2978 |
UniProt ID | P43080 |
Refseq Size | 1918 |
Cytogenetics | 6p21.1 |
Refseq ORF | 603 |
Synonyms | GUCA1A; GUCA1ANB-GUCA1A |
Summary | This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome |
Protein Pathways | Olfactory transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424724 | GUCA1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424724 | Transient overexpression lysate of guanylate cyclase activator 1A (retina) (GUCA1A) |
CNY 3080.00 |
|
PH306595 | GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400) |
CNY 19520.00 |