PNMT (NM_002686) Human Recombinant Protein
CAT#: TP306586
Recombinant protein of human phenylethanolamine N-methyltransferase (PNMT), 20 µg
View other "PNMT" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206586 protein sequence
Red=Cloning site Green=Tags(s) MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV GL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002677 |
| Locus ID | 5409 |
| UniProt ID | P11086 |
| Refseq Size | 958 |
| Cytogenetics | 17q12 |
| Refseq ORF | 846 |
| Synonyms | PENT; PNMTase |
| Summary | The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400946 | PNMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400946 | Transient overexpression lysate of phenylethanolamine N-methyltransferase (PNMT) |
CNY 3080.00 |
|
| PH306586 | PNMT MS Standard C13 and N15-labeled recombinant protein (NP_002677) |
CNY 19520.00 |
