ARSB (NM_198709) Human Recombinant Protein
CAT#: TP306565
Recombinant protein of human arylsulfatase B (ARSB), transcript variant 2, 20 µg
View other "ARSB" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 3600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206565 protein sequence
Red=Cloning site Green=Tags(s) MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPYWPECSLLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_942002 |
| Locus ID | 411 |
| UniProt ID | P15848 |
| Refseq Size | 2172 |
| Cytogenetics | 5q14.1 |
| Refseq ORF | 1239 |
| Synonyms | ASB; G4S; MPS6 |
| Summary | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400011 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404825 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400011 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 |
CNY 4840.00 |
|
| LY404825 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 2 |
CNY 3080.00 |
|
| PH306565 | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002) |
CNY 19520.00 |
|
| PH314604 | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_000037) |
CNY 19520.00 |
|
| TP314604 | Recombinant protein of human arylsulfatase B (ARSB), transcript variant 1, 20 µg |
CNY 2900.00 |


