Glycerol 3 Phosphate Dehydrogenase (GPD1) (NM_005276) Human Recombinant Protein
CAT#: TP306538
Recombinant protein of human glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1), 20 µg
View other "Glycerol 3 Phosphate Dehydrogenase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206538 protein sequence
Red=Cloning site Green=Tags(s) MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLP PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERL GIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVG AGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART GKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005267 |
| Locus ID | 2819 |
| UniProt ID | P21695 |
| Refseq Size | 3083 |
| Cytogenetics | 12q13.12 |
| Refseq ORF | 1047 |
| Synonyms | GPD-C; GPDH-C; HTGTI |
| Summary | This gene encodes a member of the NAD-dependent glycerol-3-phosphate dehydrogenase family. The encoded protein plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of dihydroxyacetone phosphate (DHAP) and reduced nicotine adenine dinucleotide (NADH) to glycerol-3-phosphate (G3P) and NAD+. The encoded cytosolic protein and mitochondrial glycerol-3-phosphate dehydrogenase also form a glycerol phosphate shuttle that facilitates the transfer of reducing equivalents from the cytosol to mitochondria. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012] |
| Protein Pathways | Glycerophospholipid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417409 | GPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417409 | Transient overexpression lysate of glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) |
CNY 3080.00 |
|
| PH306538 | GPD1 MS Standard C13 and N15-labeled recombinant protein (NP_005267) |
CNY 19520.00 |
|
| TP720715 | Purified recombinant protein of Human glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) |
CNY 3140.00 |
其它Glycerol 3 Phosphate Dehydrogenase产品
