FOXI1 (NM_144769) Human Recombinant Protein
CAT#: TP306430
Recombinant protein of human forkhead box I1 (FOXI1), transcript variant 2, 20 µg
View other "FOXI1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206430 protein sequence
Red=Cloning site Green=Tags(s) MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLS PEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREG TEV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_658982 |
| Locus ID | 2299 |
| UniProt ID | Q12951 |
| Refseq Size | 2011 |
| Cytogenetics | 5q35.1 |
| Refseq ORF | 849 |
| Synonyms | FKH10; FKHL10; FREAC-6; FREAC6; HFH-3; HFH3 |
| Summary | This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4. [provided by RefSeq, Jan 2017] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402162 | FOXI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408109 | FOXI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402162 | Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 1 |
CNY 3080.00 |
|
| LY408109 | Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 2 |
CNY 3080.00 |
|
| PH306430 | FOXI1 MS Standard C13 and N15-labeled recombinant protein (NP_658982) |
CNY 19520.00 |
|
| TP760413 | Purified recombinant protein of Human forkhead box I1 (FOXI1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
