FBXL2 (NM_012157) Human Recombinant Protein
CAT#: TP306390
Purified recombinant protein of Homo sapiens F-box and leucine-rich repeat protein 2 (FBXL2), 20 µg
View other "FBXL2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206390 protein sequence
Red=Cloning site Green=Tags(s) MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC VIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036289 |
| Locus ID | 25827 |
| UniProt ID | Q9UKC9 |
| Refseq Size | 3000 |
| Cytogenetics | 3p22.3 |
| Refseq ORF | 1269 |
| Synonyms | FBL2; FBL3 |
| Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 12 tandem leucine-rich repeats. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415925 | FBXL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432929 | FBXL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415925 | Transient overexpression lysate of F-box and leucine-rich repeat protein 2 (FBXL2), transcript variant 1 |
CNY 3080.00 |
|
| LY432929 | Transient overexpression lysate of F-box and leucine-rich repeat protein 2 (FBXL2), transcript variant 2 |
CNY 3080.00 |
|
| PH306390 | FBXL2 MS Standard C13 and N15-labeled recombinant protein (NP_036289) |
CNY 14250.00 |
