TC2N (NM_152332) Human Recombinant Protein
CAT#: TP306331
Recombinant protein of human tandem C2 domains, nuclear (TC2N), transcript variant 1, 20 µg
View other "TC2N" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206331 protein sequence
Red=Cloning site Green=Tags(s) MATEFIKSCCGGCFYGETEKHNFSVERDFKAAVPNSQNATISVPPLTSVSVKPQLGCTEDYLLSKLPSDG KEVPFVVPKFKLSYIQPRTQETPSHLEELEGSARASFGDRKVELSSSSQHGPSYDVYNPFYMYQHISPDL SRRFPPRSEVTRLYGSVCDLRTNKLPGSPGLSKSMFDLTNSSQRFIQRHDSLSSVPSSSSSRKNSQGSNR SLDTITLSGDERDFGRLNVKLFYNSSVEQIWITVLQCRDLSWPSSYGDTPTVSIKGILTLPKPVHFKSSA KEGSNAIEFMETFVFAIKLQNLQTVRLVFKIQTQTPRKKTIGECSMSLRTLSTQEMDYSLDITPPSKISV CHAELELGTCFQAVNSRIQLQILEARYLPSSSTPLTLSFFVKVGMFSSGELIYKKKTRLLKASNGRVKWG ETMIFPLIQSEKEIVFLIKLYSRSSVRRKHFVGQIWISEDSNNIEAVNQWKETVINPEKVVIRWHKLNPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689545 |
| Locus ID | 123036 |
| UniProt ID | Q8N9U0 |
| Refseq Size | 5222 |
| Cytogenetics | 14q32.12 |
| Refseq ORF | 1470 |
| Synonyms | C2CD1; C14orf47; MTAC2D1; Tac2-N |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403463 | TC2N HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426966 | TC2N HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426967 | TC2N HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403463 | Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 1 |
CNY 3080.00 |
|
| LY426966 | Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 2 |
CNY 3080.00 |
|
| LY426967 | Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 3 |
CNY 3080.00 |
|
| PH306331 | TC2N MS Standard C13 and N15-labeled recombinant protein (NP_689545) |
CNY 14250.00 |
