EIF5 (NM_001969) Human Recombinant Protein
CAT#: TP306301
Recombinant protein of human eukaryotic translation initiation factor 5 (EIF5), transcript variant 1, 20 µg
View other "EIF5" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206301 protein sequence
Red=Cloning site Green=Tags(s) MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL TEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD NKDDDIDIDAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001960 |
| Locus ID | 1983 |
| UniProt ID | P55010 |
| Refseq Size | 5963 |
| Cytogenetics | 14q32.32 |
| Refseq ORF | 1293 |
| Synonyms | EIF-5; EIF-5A |
| Summary | Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).[supplied by OMIM, May 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405302 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419615 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405302 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 |
CNY 3080.00 |
|
| LY419615 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 1 |
CNY 3080.00 |
|
| PH306301 | EIF5 MS Standard C13 and N15-labeled recombinant protein (NP_001960) |
CNY 19520.00 |
