PHYH (NM_006214) Human Recombinant Protein
CAT#: TP306277
Recombinant protein of human phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1, 20 µg
View other "PHYH" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206277 protein sequence
Red=Cloning site Green=Tags(s) MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIK NLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEIL KYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLP GTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISC HFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006205 |
| Locus ID | 5264 |
| UniProt ID | O14832 |
| Refseq Size | 1620 |
| Cytogenetics | 10p13 |
| Refseq ORF | 1014 |
| Synonyms | LN1; LNAP1; PAHX; PHYH1; RD |
| Summary | This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416793 | PHYH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421921 | PHYH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416793 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1 |
CNY 3080.00 |
|
| LY421921 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 2 |
CNY 3080.00 |
|
| PH306277 | PHYH MS Standard C13 and N15-labeled recombinant protein (NP_006205) |
CNY 19520.00 |
