ECRG4 (NM_032411) Human Recombinant Protein
CAT#: TP306239
Recombinant protein of human chromosome 2 open reading frame 40 (C2orf40), 20 µg
View other "ECRG4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206239 protein sequence
Red=Cloning site Green=Tags(s) MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG ASVNYDDY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115787 |
Locus ID | 84417 |
UniProt ID | Q9H1Z8 |
Refseq Size | 793 |
Cytogenetics | 2q12.2 |
Refseq ORF | 444 |
Synonyms | C2orf40 |
Summary | Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system (By similarity). ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403168 | C2orf40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403168 | Transient overexpression lysate of chromosome 2 open reading frame 40 (C2orf40) |
CNY 3080.00 |
|
PH306239 | C2orf40 MS Standard C13 and N15-labeled recombinant protein (NP_115787) |
CNY 19520.00 |